PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009184
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Trihelix
Protein Properties Length: 662aa    MW: 74594.4 Da    PI: 6.3154
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009184genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix43.77.2e-14140210274
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtse 74 
                  W+++evl L+++r++me +     ++   We+vs+k+ + gf+rs+++Ckek+e+ +++   i++++ + +s+
  Lus10009184 140 WSNEEVLFLLRIRSSMELNW--FPSADFTWEHVSRKLLDVGFKRSAEKCKEKFEEESRYINTINNHNHNYHSR 210
                  ****************8554..45589********************************99999999986433 PP

2trihelix902.5e-28534641186
     trihelix   1 rWtkqevlaLiearr....................emeerlrrgk...........lkkplWeevskkmrergferspkqCkekwenlnkrykkikeg 67 
                  rW+++evlaLi++r                     e        k            k+plWe++s+ m+e g+ rs+k+Ckekwen+nk+++k+k+ 
  Lus10009184 534 RWPRDEVLALINLRCgiynnnsngggrnevvavvaE--------KeggggsasnsnNKAPLWERISRGMSELGYGRSAKRCKEKWENINKYFRKTKDL 623
                  8**************777766666666666666553........033333344444****************************************** PP

     trihelix  68 ekkrtsessstcpyfdqle 86 
                  +kkr s +s+tcpyf+ql 
  Lus10009184 624 NKKR-SLDSRTCPYFHQLS 641
                  ***8.9999********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.4136196IPR001005SANT/Myb domain
PfamPF138375.2E-9138208No hitNo description
PROSITE profilePS500906.11140194IPR017877Myb-like domain
SMARTSM007170.15531616IPR001005SANT/Myb domain
PfamPF138371.3E-17533642No hitNo description
CDDcd122031.82E-21533621No hitNo description
PROSITE profilePS500905.691587614IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MFEGVAPPSD QFHKFTPNPS SSPSPHLPLH LSFASSSSSS SSSSSSSTPP IFPISFDPYH  60
HHNHHHHHLH QQHQHQVVPP AAPSILLHPN FFHPLNFNPH SNNTAPGATT RSIIKNINAH  120
EDKELVEAAA SIIQQQDPAW SNEEVLFLLR IRSSMELNWF PSADFTWEHV SRKLLDVGFK  180
RSAEKCKEKF EEESRYINTI NNHNHNYHSR AFSSHDDLVN HLHNHDDGSH PQLYHNNNDN  240
IANNNNKTTN QEDDDDGDGE HLAKQVDEQK DKIDDDDDDQ DHTAASGDTD RTGDDDNDHD  300
DDGGGGKQDP VNQVQNPSSS SNGNNITKSI NNDDGIHLQH NSKKREKRKR EGDKFEMFKG  360
FCQDIVDKMM AQQEDMQNKL IEDMIKRDQE KLASEEAWKK QEMDRINQDL QLRSDQQSLA  420
GDRQSSILKF LENFPNPHQL VDPYHHSIQK VPIMINNNII CNPIPTSSSS SSAASQPNPT  480
HTESQSHPIQ SEFKSIQNDG NPDSRSKNNP PNPSRKPIVV GELENRQREE VGKRWPRDEV  540
LALINLRCGI YNNNSNGGGR NEVVAVVAEK EGGGGSASNS NNKAPLWERI SRGMSELGYG  600
RSAKRCKEKW ENINKYFRKT KDLNKKRSLD SRTCPYFHQL SSLYGGNAAT EEPGTVPEIL  660
Q*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50433355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28300.19e-37Trihelix family protein